PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013585304.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 252aa    MW: 28856.1 Da    PI: 5.6778
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013585304.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.48.8e-151663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W+ +Ed++l+  ++++G ++W++ ++  g+ R++k+c++rw +yl
   XP_013585304.1 16 RGQWSYDEDLKLISFINKYGHENWRSLPEQAGLLRCGKSCRLRWINYL 63
                     89******************************99************97 PP

2Myb_DNA-binding482.8e-1569114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ eE+e ++++++  G++ W++Ia++++ gRt++++k+ w+++l
   XP_013585304.1  69 RGNFSVEEEETIIKLHQSIGSK-WSKIASKLP-GRTDNEIKNVWHTHL 114
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.9E-23766IPR009057Homeodomain-like
PROSITE profilePS5129413.0261163IPR017930Myb domain
SuperFamilySSF466895.14E-2814110IPR009057Homeodomain-like
SMARTSM007173.6E-101565IPR001005SANT/Myb domain
PfamPF002496.6E-141663IPR001005SANT/Myb domain
CDDcd001677.95E-81963No hitNo description
PROSITE profilePS5129423.2664118IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-2567118IPR009057Homeodomain-like
SMARTSM007177.7E-1368116IPR001005SANT/Myb domain
PfamPF002495.6E-1469114IPR001005SANT/Myb domain
CDDcd001672.16E-871114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MGKGRAPCCD KTKVKRGQWS YDEDLKLISF INKYGHENWR SLPEQAGLLR CGKSCRLRWI  60
NYLRPDVKRG NFSVEEEETI IKLHQSIGSK WSKIASKLPG RTDNEIKNVW HTHLKKRLSS  120
NTNLNADRDE AATKGYLNRE ETSQESSPNA SMSFGGSKIS SKEDGVQIGQ TFQYLEGHSE  180
VTRTLQEVDK PELLEIPFGV DPEIWSFING LDSFQQPENS LAPWAHQDSQ EDEVEKWFKH  240
LETDLGLEEN DS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-23161207110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013585304.10.0PREDICTED: myb-related protein Zm1-like
TrEMBLA0A0D3CAS70.0A0A0D3CAS7_BRAOL; Uncharacterized protein
STRINGBra026048.1-P1e-173(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G16490.11e-147myb domain protein 58